PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00002.1.g05520.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family Dof
Protein Properties Length: 354aa    MW: 35825 Da    PI: 8.2175
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00002.1.g05520.1.sm.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.92.6e-3940100262
                        zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                                   +e+ l+cprCds ntkfCyynnyslsqPr+fCk+CrryWtkGGalrnvPvGgg+rknk+s+
  Zjn_sc00002.1.g05520.1.sm.mk  40 PEQGLRCPRCDSPNTKFCYYNNYSLSQPRHFCKTCRRYWTKGGALRNVPVGGGCRKNKRSR 100
                                   67899*****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027017.3E-334298IPR003851Zinc finger, Dof-type
ProDomPD0074783.0E-284497IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.6094498IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104682IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 354 aa     Download sequence    Send to blast
MASSTAVAAS GDDVAGPRKQ GTGGTTPPPA PQQQPPPPPP EQGLRCPRCD SPNTKFCYYN  60
NYSLSQPRHF CKTCRRYWTK GGALRNVPVG GGCRKNKRSR SAASASAAAV AAASSRLSLN  120
LPVEGIGGAS ADQQAAARLG FLGGGAPLPV VSSPIGAASA SDFHGGSAVG MMALPRFNAP  180
AVGHYVPFGE WPSAPGVDIS CGGGSGNGGH AMSGGQTGAV SSSIASSIES LSFINQDLHW  240
KLQQQRLATM FLGPPPSSGT TVHVEGAAAA PEHVGGPFLQ MAGTSTMEAV PAATSWFMDS  300
SYVLPPPPAT IVTTTNGNVQ SGRSSADDDN ATSNNNCGSA IPAWGDMSTF AMLP
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9475243e-86EU947524.1 Zea mays clone 346044 mRNA sequence.
GenBankKJ7269773e-86KJ726977.1 Zea mays clone pUT3678 C2C2-DOF transcription factor (DOF32) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004982507.11e-115PREDICTED: dof zinc finger protein DOF5.7-like
TrEMBLK4ABQ41e-115K4ABQ4_SETIT; Uncharacterized protein
STRINGSi036311m1e-114(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.16e-33TARGET OF MONOPTEROS 6